« Back
Home /
SLC34A3 Antibody - middle region

SLC34A3 Antibody - middle region

Item no.	ARP31567_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Food Safety Antibodies Western Blot Primary Antibodies GMO
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL
Citations	Yamamoto,T., (2007) J. Bone Miner. Metab. 25 (6), 407-413
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	HHRH,NPTIIc
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	63kDa
Species Tested	Human
Gene symbol	SLC34A3
Gene Fullname	Solute carrier family 34 (sodium phosphate), member 3
Protein size	599
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	SNTA1; PDZK1;
Description of target	SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney (Segawa et al., 2002 [PubMed 11880379]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-942 AK095999.1 1-942 943-2142 AB055000.1 827-2026
Nucleotide accession_num	NM_080877
Protein accession_num	NP_543153
Protein name	Sodium-dependent phosphate transport protein 2C
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human SLC34A3
Homology	Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rat: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 11/27/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer