Comparison

COPS2 Antibody - N-terminal region

Item no. ARP34189_T100-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Goat (Caprine, Capra aegagrus hircus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host Rabbit
Sequence MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA
Citations Anti-Csn2 ARP34189_T100 has recently been referenced in the following publications:Pick, E. et al. The minimal deneddylase core of the COP9 signalosome excludes the Csn6 MPN- domain. PLoS One 7, e43980 (2012). WB, Mouse 22956996
Moehren,U., (2004) (er) Nucleic Acids Res. 32 (10), 2995-3004
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CSN2,SGN2,ALIEN,TRIP15
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Neuroscience, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
52kDa
Species Tested
Human
Gene symbol
COPS2
Gene Fullname
COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
Protein size
443
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8;
Description of target
COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/Ion ChannelSBP. COPS2 is also innvolved in early stage of neuronal differentiation via its interaction with NIF3L1.
Subunit
2
Nucleotide accession_num
NM_004236
Protein accession_num
NP_004227
Protein name
COP9 signalosome complex subunit 2
Clonality
Polyclonal
Purification
Protein A purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2
Homology
Cow: 100%; Dog: 100%; Goat: 91%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100%
Concentration
1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close