« Back
Home /
PHF11 Antibody - middle region

PHF11 Antibody - middle region

Item no.	ARP34848_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Protein Aggregation, Clearance & Misfolding Antibodies By Cell Type Carcinoma Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Dog (Canine, Canis lupus familiaris)
Host	Rabbit
Sequence	FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF
Citations	Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	APY,BCAP,IGEL,IGER,IGHER,NYREN34,NY-REN-34
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	37kDa
Species Tested	Human
Gene symbol	PHF11
Gene Fullname	PHD finger protein 11
Protein size	331
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	MCPH1; LSM8; PIAS4; AGPAT2; CSNK2B;
Description of target	PHF11 contains two PHD zinc fingers and probably regulates transcription. Distinctive splice variants were expressed in immune tissues and cells.
Nucleotide accession_num	NM_001040443
Protein accession_num	NP_001035533
Protein name	PHD finger protein 11
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human PHF11
Homology	Dog: 85%; Human: 100%
Concentration	0.5 mg/ml
Sample Type Confirmation	PHF11 is supported by BioGPS gene expression data to be expressed in HepG2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer