« Back
Home /
RNF113B Antibody - middle region

RNF113B Antibody - middle region

Item no.	ARP34874_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Protein Aggregation, Clearance & Misfolding Antibodies Western Blot Primary Antibodies By Organ Bladder Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	MGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIYRGIHSYLRYL
Citations	Dunham,A., (2004) Nature 428 (6982), 522-528
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RNF161,ZNF183L1,bA10G5.1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	36kDa
Species Tested	Human
Gene symbol	RNF113B
Gene Fullname	Ring finger protein 113B
Protein size	322
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBE2R2; UBE2L3; UBE2H; UBE2U;
Description of target	RNF113B contains 1 RING-type zinc finger and 1 C3H1-type zinc finger and the function remains unknown.
Nucleotide accession_num	NM_178861
Protein accession_num	NP_849192
Protein name	RING finger protein 113B
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human RNF113B
Homology	Human: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer