« Back
Home /
Kcnh2 Antibody - C-terminal region

Kcnh2 Antibody - C-terminal region

Item no.	ARP34928_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Antibodies By Cell Type Blastoma Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	RRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSPES
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	LQ,ERG,LQT,ERG1,Lqt2,M-er,M-erg,Merg1,merg1a,merg1b,AI326795
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Signal Transduction, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	127kDa
Species Tested	Mouse
Gene symbol	KCNH2
Gene Fullname	Potassium voltage-gated channel, subfamily H (eag-related), member 2
Protein size	1162
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Kcnh2 is a pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. It mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr).
Nucleotide accession_num	NM_013569
Protein accession_num	NP_038597
Protein name	Potassium voltage-gated channel subfamily H member 2
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer