« Back
Home /
GABRR1 Antibody - N-terminal region

GABRR1 Antibody - N-terminal region

Item no.	ARP35058_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Protein Aggregation, Clearance & Misfolding Antibodies Western Blot Primary Antibodies Astroglia Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	EMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDDH
Citations	Jansen,M., (2008) J. Gen. Physiol. 131 (2), 137-146
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MGC163216
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies/Ion Channel, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Receptors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	55kDa
Species Tested	Human
Gene symbol	GABRR1
Gene Fullname	Gamma-aminobutyric acid (GABA) A receptor, rho 1
Protein size	473
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; FEZF1; IP6K2; DNM1L; TAX1BP1; GABRR1; BCR; Camk2n1; Prkcg; Mapk3; PRKACA; PRKG1; CSNK2A1; P2RX2; GABRR2; SQSTM1; SLC6A9; PRKCA; MAPK1; MAP1B;
Description of target	GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Subunit	rho-1
Nucleotide accession_num	NM_002042
Protein accession_num	NP_002033
Protein name	Gamma-aminobutyric acid receptor subunit rho-1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human GABRR1
Homology	Cow: 83%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 92%; Zebrafish: 83%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer