« Back
Home /
GABRR2 Antibody - middle region

GABRR2 Antibody - middle region

Item no.	ARP35060_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
Citations	Fatemi, S. H., Folsom, T. D., Rooney, R. J. & Thuras, P. D. mRNA and protein expression for novel GABAA receptors ÃŽÂ¸ and ÃÂ2 are altered in schizophrenia and mood disorders relevance to FMRP-mGluR5 signaling pathway. Transl. Psychiatry 3, e271 (2013). 23778581 Cavalleri,G.L., (2007) Lancet Neurol 6 (11), 970-980
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Ion Channel, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Receptors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	54kDa
Species Tested	Human
Gene symbol	GABRR2
Gene Fullname	Gamma-aminobutyric acid (GABA) A receptor, rho 2
Protein size	490
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	GABRR1; SQSTM1; PRKCA; MAP1B; CSNK2A1;
Description of target	GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 BX490975.1 60-89 31-1586 BC130352.1 1-1556 1587-1631 M86868.1 1584-1628
Subunit	rho-2
Nucleotide accession_num	NM_002043
Protein accession_num	NP_002034
Protein name	Gamma-aminobutyric acid receptor subunit rho-2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human GABRR2
Homology	Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Concentration	0.5 mg/ml
Sample Type Confirmation	GABRR2 is supported by BioGPS gene expression data to be expressed in HEK293T

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer