Comparison

CLCNKA Antibody - N-terminal region

Item no. ARP35132_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW
Citations Kramer,B.K., (2008) Nat Clin Pract Nephrol 4 (1), 38-46
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CLCK1,ClC-K1,hClC-Ka
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Ion Channel, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
75kDa
Species Tested
Human
Gene symbol
CLCNKA
Gene Fullname
Chloride channel, voltage-sensitive Ka
Protein size
687
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
CLCNKA is a member of the CLC family of voltage-gated chloride channels. It is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Nucleotide accession_num
NM_004070
Protein accession_num
NP_004061
Protein name
Chloride channel protein ClC-Ka
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CLCNKA
Homology
Cow: 90%; Human: 100%; Mouse: 85%; Pig: 85%; Rat: 85%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close