« Back
Home /
KCND3 Antibody - middle region

KCND3 Antibody - middle region

Item no.	ARP35165_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Neural Signaling Antibodies Western Blot Primary Antibodies By Organ Skin Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE
Citations	Hatano,N., et al., (2004) J. Biol. Chem. 279 (7), 5450-5459
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KV4.3,SCA19,SCA22,BRGDA9,KCND3L,KCND3S,KSHIVB
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Cardiovascular, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	70kDa
Species Tested	Human, Rat
Gene symbol	KCND3
Gene Fullname	Potassium voltage-gated channel, Shal-related subfamily, member 3
Protein size	636
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	NDUFS2; NAP1L1; LBR; HSPA8; HSPA5; HNRNPF; XRCC6; EWSR1; EMD; DDB1; CUX1; CDK1; AUP1; NONO; XRCC5; UQCRC2; TUBB2A; RCN2; Rapgef5; Rapgef4; Kcnip1; Rapgef3; Kcnip2; DPP10; PYCR2; VPS4A; TUBA1B; G3BP1; RUVBL1; CNBP; SRC; KCND3;
Description of target	Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.
Nucleotide accession_num	NM_172198
Protein accession_num	NP_751948
Protein name	Potassium voltage-gated channel subfamily D member 3
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human KCND3
Homology	Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer