« Back
Home /
ZNF2 Antibody - N-terminal region

ZNF2 Antibody - N-terminal region

Item no.	ARP35997_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Mesothelioma Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	KFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQ
Citations	Rocchi,M., et al., (1999) Cytogenet. Cell Genet. 86 (3-4), 305-306
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	A1-5,ZNF661,Zfp661
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	33kDa
Species Tested	Human
Gene symbol	ZNF2
Gene Fullname	Zinc finger protein 2
Protein size	292
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	KRTAP10-7; TSGA10; PRMT5; TRIM28; APP;
Description of target	The ZNF2 gene is part of a sub-family of structurally related finger protein genes. Members of this sub-family are expressed as multiple transcripts in several cell lines.
Nucleotide accession_num	NM_021088
Protein accession_num	NP_066574
Protein name	Zinc finger protein 2
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF2
Homology	Human: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer