Comparison

Dnmt1 Antibody - N-terminal region

Item no. ARP37033_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Mouse (Murine, Mus musculus)
Host Rabbit
Sequence SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias MTa,Dnmt,MCMT,Met1,Cxxc9,MTase,Met-1,Dnmt1o,MommeD,m.MmuI,MommeD2
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Methylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
183kDa
Species Tested
Mouse
Gene symbol
DNMT1
Gene Fullname
DNA methyltransferase (cytosine-5) 1
Protein size
1619
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Uhrf1; Parp1; Eed; hist1h3g; DSK2; VPS9; Kat5; Ubc; Atm; NUB1; UBQLN1; SQSTM1; PSMD4; NBR1; RAD23B; Hesx1; Ezh2; Zbtb16; Cul3; Cdh1; Dmap1; Tcf3; hist1h4a; hist1h2bj; hist2h2ab; Dnmt1; Kcnq1ot1; Pla2g2a; Apc; Tox3; Rela; HDAC1;
Description of target
Dnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.
Nucleotide accession_num
NM_010066
Protein accession_num
NP_034196
Protein name
DNA (cytosine-5)-methyltransferase 1
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse Dnmt1
Homology
Mouse: 100%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close