Comparison

Eomes Antibody - C-terminal region

Item no. ARP37036_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB, IHC
Specific against Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host Rabbit
Sequence SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Tbr,Tbr2,TBR-2,C77258
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
75kDa
Species Tested
Human, Mouse
Gene symbol
EOMES
Gene Fullname
Eomesodermin homolog (Xenopus laevis)
Protein size
707
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
Eomes functions as a transcriptional activator playing a crucial role during development. Eomes functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification.Eomes plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Eomes also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes.
Nucleotide accession_num
NM_010136
Protein accession_num
NP_034266
Protein name
Eomesodermin homolog
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human Eomes
Homology
Cow: 80%; Dog: 80%; Guinea Pig: 80%; Mouse: 100%; Rat: 87%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close