« Back
Home /
Fkhl18 Antibody - C-terminal region

Fkhl18 Antibody - C-terminal region

Item no.	ARP37041_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Antibodies By Cell Type Cell Biology Cell Status Apoptosis Western Blot Primary Antibodies By Organ Skin Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Fkh3,FREAC,Fkhl1,Fkhl18,FREAC10
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/Mitochondria, Root Catalog/Research Areas/DNA Damage & Repair, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	35
Species Tested	Mouse
Gene symbol	FOXS1
Gene Fullname	Forkhead box S1
Protein size	329
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Fkhl18 is a transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters.Fkhl18 may have a role in the organization of the testicular vasculature.
Nucleotide accession_num	NM_010226
Protein accession_num	NP_034356
Protein name	Forkhead box protein S1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the c terminal region of mouse Fkhl18
Homology	Cow: 86%; Guinea Pig: 79%; Horse: 86%; Mouse: 100%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer