Comparison

NFATC2 Antibody - N-terminal region

Item no. ARP37106_T100-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK
Citations Heer, R. et al. Phenotypic modulation of human urinary tract stroma-derived fibroblasts by transforming growth factor beta3. Urology 76, 509.e13-20 (2010). 20546875
Nagamoto-Combs, K. & Combs, C. K. Microglial phenotype is regulated by activity of the transcription factor, NFAT (nuclear factor of activated T cells). J. Neurosci. 30, 9641-6 (2010). 20631193
Glud,S.Z., et al., (2005) Blood 106 (10), 3546-3552
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias NF,NFA,NFAT1,Nfatp,NF-ATp,NF-ATc2,NFAT1-D,AI607462
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Axon Guidance, Root Catalog/Research Areas/MAPK Signaling, Root Catalog/Research Areas/WNT Signaling, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
100kDa
Species Tested
Mouse
Gene symbol
NFATC2
Gene Fullname
Nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2
Protein size
927
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Foxp3; Il4; Ifng; Nfatc2ip;
Description of target
NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation
Nucleotide accession_num
NM_010899
Protein accession_num
NP_035029
Protein name
Nuclear factor of activated T-cells, cytoplasmic 2
Clonality
Polyclonal
Purification
Protein A purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2
Homology
Cow: 86%; Dog: 82%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 79%; Rat: 93%
Concentration
1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close