« Back
Home /
CCL5 Antibody - middle region

CCL5 Antibody - middle region

Item no.	ARP37191_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Neural Signaling Antibodies Western Blot Primary Antibodies Neuronal Cell Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN
Citations	Palaniappan,R., et al., (2006) J. Immunol. 176 (4), 2346-2356
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	S,RA,Scy,MuRa,SISd,Scya5,TCP22,RANTES,TCP228,MuRantes
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	10kDa
Species Tested	Mouse
Gene symbol	CCL5
Gene Fullname	Chemokine (C-C motif) ligand 5
Protein size	91
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Ccr1;
Description of target	Recently, it has been shown that genetic polymorphisms can result in diminished expression of CCL5, which results in increased susceptibility to and progression of infectious diseases. CCL5, together with Th cytokine mRNA expression, is temporally up-regulated during pneumococcal carriage. CCL5 is an essential factor for the induction and maintenance of protective pneumococcal immunity
Nucleotide accession_num	NM_013653
Protein accession_num	NP_038681
Protein name	C-C motif chemokine 5
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse CCL5
Homology	Cow: 85%; Dog: 91%; Guinea Pig: 85%; Horse: 85%; Human: 85%; Mouse: 100%; Pig: 91%; Rabbit: 85%; Rat: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 12/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer