« Back
Home /
Research Area /
Oncology /
Rybp Antibody - N-terminal region

Rybp Antibody - N-terminal region

Item no.	ARP37264_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Targets for Rodent Neurosciences Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Adenocarcinoma Western Blot Primary Antibodies Astrocytoma By Organ Breast Cancer Heart & Blood Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Yeast (Saccharomyces cerevisiae), Cow (Bos taurus)
Host	Rabbit
Sequence	RINSQLVAQQVAQQYATPPPPKKEKKEKVEKPDKEKPEKDKDISPSVTKK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DEDA,DEDAF,YEAF1,2410018J24Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Apoptosis, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	25kDa
Species Tested	Mouse
Gene symbol	RYBP
Gene Fullname	RING1 and YY1 binding protein
Protein size	228
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Eed; Nanog; Pcgf1; Kdm2b; Rnf2; L3mbtl2; Pcgf6; Rybp; Pcgf2; Ring1; UBC; Tfcp2l1; Pou5f1;
Description of target	Rybp inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes. It may be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1 and may bind to DNA. It promotes apoptosis.
Nucleotide accession_num	NM_019743
Protein accession_num	NP_062717
Protein name	RING1 and YY1-binding protein
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rybp
Homology	Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 92%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 85%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer