« Back
Home /
Toe1 Antibody - middle region

Toe1 Antibody - middle region

Item no.	ARP37368_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies By Cell Type Carcinoma Hematology Lymphoma Melanoma Sarcoma Cell Biology Cell Status Apoptosis Western Blot Senescence Primary Antibodies By Organ Lung Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	AI413517,4930584N22Rik,4933424D16Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	57kDa
Species Tested	Mouse
Gene symbol	TOE1
Gene Fullname	Target of EGR1, member 1 (nuclear)
Protein size	511
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	Toe1 inhibits cell growth rate and cell cycle. Toe1 induces CDKN1A expression as well as TGF-beta expression.Toe1 mediates the inhibitory growth effect of EGR1.
Nucleotide accession_num	NM_026654
Protein accession_num	NP_080930
Protein name	Target of EGR1 protein 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of mouse Toe1
Homology	Mouse: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer