Comparison

Jundm2 Antibody - N-terminal region

Item no. ARP37413_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host Rabbit
Sequence MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TI,TIF,Jundm,Jundm2,Jundp2
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
19kDa
Species Tested
Mouse
Gene symbol
JDP2
Gene Fullname
Jun dimerization protein 2
Protein size
163
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Atf2; Hdac1; Hdac3; Hdac2; Jdp2; Taf13; Pbx4; Polr2i; Meis3; Dlx5; Dbp; Cebpg; Cebpa; Alx3; Jun;
Description of target
Jundm2 is a component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Jundm2 is involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris.Jundm2 can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN.Jundm2 may control transcription via direct regulation of the modification of histones and the assembly of chromatin.
Nucleotide accession_num
NM_030887
Protein accession_num
NP_112149
Protein name
Jun dimerization protein 2
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Jundm2
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close