« Back
Home /
Jundm2 Antibody - C-terminal region

Jundm2 Antibody - C-terminal region

Item no.	ARP37414_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Aging & Neurological Disorders Neural Epigenetics Antibodies By Cell Type Carcinoma Melanoma Western Blot Primary Antibodies By Organ Bladder Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	LKTQIEELKLERQQLILMLNRHRPTCIVRTDSVRTPESEGNPLLEQLDKK
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TI,TIF,Jundm,Jundm2,Jundp2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	19kDa
Species Tested	Mouse
Gene symbol	JDP2
Gene Fullname	Jun dimerization protein 2
Protein size	163
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Atf2; Hdac1; Hdac3; Hdac2; Jdp2; Taf13; Pbx4; Polr2i; Meis3; Dlx5; Dbp; Cebpg; Cebpa; Alx3; Jun;
Description of target	Jundm2 is a component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Jundm2 is involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris.Jundm2 can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN.Jundm2 may control transcription via direct regulation of the modification of histones and the assembly of chromatin.
Nucleotide accession_num	NM_030887
Protein accession_num	NP_112149
Protein name	Jun dimerization protein 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the c terminal region of mouse Jundm2
Homology	Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer