« Back
Home /
Rbfox2 Antibody - N-terminal region

Rbfox2 Antibody - N-terminal region

Item no.	ARP37551_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Fxh,Rbm,Fbm2,Rbm9,Hrnbp2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	47kDa
Species Tested	Mouse
Gene symbol	RBFOX2
Gene Fullname	RNA binding protein, fox-1 homolog (C. elegans) 2
Protein size	445
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Nanog; Med16; Rbfox2; Fyn;
Description of target	Rbm9 is a RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements.Rbm9 prevents binding of U2AF2 to the 3'-splice site. Rbm9 regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. Rbm9 seems to act as a coregulatory factor of ER-alpha.
Nucleotide accession_num	NM_001110827
Protein accession_num	NP_001104297
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rbfox2
Homology	Human: 79%; Mouse: 100%; Pig: 79%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer