« Back
Home /
ZHX2 Antibody - C-terminal region

ZHX2 Antibody - C-terminal region

Item no.	ARP37629_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Carcinoma Western Blot Primary Antibodies By Organ Lung Cancer Hepatic Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA
Citations	Perincheri,S., et al., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (2), 396-401
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	R,Af,Afr,Raf,Afr1,Afr-1,mKIAA0854
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	92kDa
Species Tested	Mouse
Gene symbol	ZHX2
Gene Fullname	Zinc fingers and homeoboxes 2
Protein size	836
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Pxn; Kras; Hras;
Description of target	ZHX2 a zinc fingers and homeoboxes (ZHX) protein that is directly involved in the regulation of AFP synthesis. It also controls AFP levels only indirectly, e.g., by regulating the synthesis of a hormone that controls AFP synthesis.
Nucleotide accession_num	NM_199449
Protein accession_num	NP_955520
Protein name	Zinc fingers and homeoboxes protein 2
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of mouse ZHX2
Homology	Cow: 86%; Dog: 86%; Horse: 79%; Human: 79%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer