« Back
Home /
Fam172a Antibody - N-terminal region

Fam172a Antibody - N-terminal region

Item no.	ARP37640_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Sequence	MTFKFPADPEVQSNLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHC
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	pEN,53-E6,pEN87,AF064782,1110033M05Rik,2610318O14Rik,9430037D06Rik
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	48kDa
Species Tested	Mouse
Gene symbol	FAM172A
Gene Fullname	Family with sequence similarity 172, member A
Protein size	438
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The amino acid sequence of 1110033M05Rik is derived from an annotated genomic sequence (NT_039589) using gene prediction method: GNOMON, supported by mRNA and EST evidence.
Nucleotide accession_num	XM_193728
Protein accession_num	XP_193728
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse 1110033M05RIK
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer