« Back
Home /
RELB Antibody - N-terminal region

RELB Antibody - N-terminal region

Item no.	ARP37870_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Aging & Neurological Disorders Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host	Rabbit
Sequence	MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGL
Citations	Phan,H.H., et al., (2006) Gene 371 (1), 121-129
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	sh,shep
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Immunology, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	61kDa
Species Tested	Mouse
Gene symbol	RELB
Gene Fullname	Avian reticuloendotheliosis viral (v-rel) oncogene related B
Protein size	558
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Nanog; Nfkb2; Nfkb1;
Description of target	RelB is a member of the Rel/nuclear factor (NF)-kappa B family of transcription factors, defects in RelB affects antigen presenting cells and the formation of lymphoid organs. Targeted disruption of the Rel/NF-kappaB family members NF-kappaB2, encoding p100/p52, and RelB in mice results in anatomical defects of secondary lymphoid tissues.
Nucleotide accession_num	NM_009046
Protein accession_num	NP_033072
Protein name	Transcription factor RelB
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of mouse RELB
Homology	Cow: 86%; Dog: 93%; Human: 93%; Mouse: 100%; Rat: 86%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer