Comparison

Runx1 Antibody - N-terminal region

Item no. ARP37877_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host Rabbit
Sequence KMSEALPLGAPDGGPALASKLRSGDRSMVEVLADHPGELVRTDSPNFLCS
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias AM,AML1,Cbfa,Pebp,Cbfa2,Pebp2a2,Pebpa2b,CBF-alpha-2
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Neurobiology, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Signal Transduction, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature
Wet Ice
Molecular Weight
42kDa
Species Tested
Mouse
Gene symbol
RUNX1
Gene Fullname
runt related transcription factor 1
Protein size
387
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
Kat6a; Ubc; Cbfb; Foxp3; Rbbp4; Gata1; Fli1; Phc1; Cdk6; Cbx3; Bmi1; Pml; Mbd3; Smad2; Prmt1; Hdac2; Hcfc1; Gata2; Hdac1; Wdr5; Mta1; Smarcd1; Pcgf5; Smarcc2; Pold3; Smarce1; Set; Mta2; Ash2l; Tal1; Smarcc1; Smarcb1; Smarca4; Sin3a; Rnf2; Ring1; Cbfa2t3;
Description of target
CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. Runx1 is essential for the development of normal hematopoiesis. Isoform 4 shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation. Runx1 acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter. It inhibits KAT6B-dependent transcriptional activation .
Nucleotide accession_num
NM_009821
Protein accession_num
NP_033951
Protein name
Runt-related transcription factor 1
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Runx1
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close