« Back
Home /
LMX1A Antibody - C-terminal region

LMX1A Antibody - C-terminal region

Item no.	ARP37928_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD
Citations	RIKEN (2005) Science 309 (5740), 1564-1566
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	dr,sst,Lmx1.,Lmx1.1,dreher
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Growth Factors & Hormones, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	42kDa
Species Tested	Mouse
Gene symbol	LMX1A
Gene Fullname	LIM homeobox transcription factor 1 alpha
Protein size	382
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Phf10; Ssbp2; Ldb2; Ldb1; BMPR2;
Description of target	Lmx1a acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. It is required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.
Nucleotide accession_num	NM_033652
Protein accession_num	NP_387501
Protein name	LIM homeobox transcription factor 1-alpha
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer