« Back
Home /
GTF2H4 Antibody - N-terminal region

GTF2H4 Antibody - N-terminal region

Item no.	ARP38046_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Neural Lineage Markers Neural Transcription Factors Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Epigenetics Protein Aggregation, Clearance & Misfolding Antibodies Western Blot Primary Antibodies Neurodegeneration Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Guinea Pig, Goat (Caprine, Capra aegagrus hircus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPS
Citations	Weber,A., (2005) Mol. Cell. Biol. 25 (1), 147-161
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P52,TFB2,TFIIH
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/DNA Damage & Repair, Root Catalog/Research Areas/DNA Repair, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	52kDa
Species Tested	Human
Gene symbol	GTF2H4
Gene Fullname	General transcription factor IIH, polypeptide 4, 52kDa
Protein size	462
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; CDK7; RNF11; TP53; MNAT1; GTF2H3; GTF2H2; GTF2H1; ERCC3; CCNH; XBP1P1; MYC; GTF2E1; ERCC5; MED21; BTAF1; TBP; POLR2A; GTF2F1; GTF2B; BRCA1;
Description of target	GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Subunit	4
Nucleotide accession_num	NM_001517
Protein accession_num	NP_001508
Protein name	General transcription factor IIH subunit 4
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2H4
Homology	Cow: 93%; Dog: 87%; Goat: 93%; Guinea Pig: 87%; Human: 100%; Pig: 93%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer