« Back
Home /
Ighmbp2 Antibody - N-terminal region

Ighmbp2 Antibody - N-terminal region

Item no.	ARP38126_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Antibodies By Cell Type Melanoma Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host	Rabbit
Sequence	QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL
Citations	Rescue of a Mouse Model of Spinal Muscular Atrophy With Respiratory Distress Type 1 by AAV9-IGHMBP2 Is Dose Dependent. Mol. Ther. 24, 855-66 (2016). 26860981
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	A,s,AEP,Smb,nmd,sma,Catf,RIPE,Smbp,Smub,Catf1,Smbp2,Smbp-2,Smubp2,RIPE3b1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	109 kDa
Species Tested	Mouse
Gene symbol	IGHMBP2
Gene Fullname	Immunoglobulin mu binding protein 2
Protein size	993
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Gtf3c1; Hnrnph1; Ruvbl1; Abt1; Zbtb14; Tyr; Ighmbp2; Ruvbl2; Hspa1b; Slit3; Robo1;
Description of target	Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.
Nucleotide accession_num	NM_009212
Protein accession_num	NP_033238
Protein name	DNA-binding protein SMUBP-2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer