« Back
Home /
PITX1 Antibody - C-terminal region

PITX1 Antibody - C-terminal region

Item no.	ARP38176_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Metabolism Glucose Homeostasis Antibodies Cell Biology Cell Status Necrosis Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	GTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
Citations	Lord,R.V., et al., (2005) Surgery 138 (5), 924-931
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	BFT,CCF,POTX,PTX1,LBNBG
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Cell Structure, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	34kDa
Species Tested	Human, Mouse
Gene symbol	PITX1
Gene Fullname	Paired-like homeodomain 1
Protein size	314
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	RBPMS; RFX6; MGAT5B; PRR20A; C1orf94; LZTS2; ALG13; RNF31; ZBTB32; SPAG8; IPO13; MAGED1; HGS; PLSCR1; CDX4; TRIM23; UPF2; SMAD3; SMARCA2; NEUROD1; DVL3; RHOXF2; NR5A1; POU1F1; EGR1; RASAL1;
Description of target	PITX1 is a member of the RIEG/PITX homeobox family, which is involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.
Nucleotide accession_num	NM_002653
Protein accession_num	NP_002644
Protein name	Pituitary homeobox 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human PITX1
Homology	Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Rat: 93%; Zebrafish: 79%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer