« Back
Home /
PSMC5 Antibody - C-terminal region

PSMC5 Antibody - C-terminal region

Item no.	ARP38192_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Antibodies Immunohistochemistry Immunoprecipitation Western Blot Primary Antibodies By Organ Thyroid Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IP, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Citations	Effects of aging and reproduction on protein quality control in soma and gametes of Drosophila melanogaster. Aging Cell. 11, 634-43 (2012). 22507075 Inoue,T., et al., (2006) Biochem. Biophys. Res. Commun. 342 (3), 829-834
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	S8,p45,RPT6,SUG1,SUG-1,TBP10,TRIP1,p45/SUG
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	46kDa
Species Tested	Human, Mouse
Gene symbol	PSMC5
Gene Fullname	Proteasome (prosome, macropain) 26S subunit, ATPase, 5
Protein size	406
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	HUWE1; KRT38; KRT40; PDCL; CIITA; FOS; THAP11; SUMO2; SUMO3; Gabbr2; PSMD14; UBE3C; UBC; PSMB4; RPS13; RPL29; PSMD12; PSMD11; PSMD8; PSMD3; PSMD1; PSMC6; DYNC1I2; ABCF1; KCMF1; UCHL5; KIAA0368; UBR4; ADRM1; MAP2; PARK2; FBXO6; RORA; PSMC4; BAG3; HIV2gp7;
Description of target	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits.PSMC5 is one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha.
Subunit	8
Nucleotide accession_num	NM_002805
Protein accession_num	NP_002796
Protein name	26S protease regulatory subunit 8
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC5
Homology	Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer