Comparison

REL Antibody - middle region

Item no. ARP38198_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence CADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQ
Citations Kakizuka,A., (er) Ann. Rheum. Dis. (2008) In press
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias C-Rel,HIVEN86A
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature
Wet Ice
Molecular Weight
68kDa
Species Tested
Human
Gene symbol
REL
Gene Fullname
V-rel reticuloendotheliosis viral oncogene homolog (avian)
Protein size
619
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
NFKB2; REXO1L6P; C12orf75; TRIM74; RAB41; BARHL2; SEC14L4; NUDT14; ZDHHC24; NEIL2; CPNE2; C9orf72; STRA13; TTC21A; FUT11; ZNF564; ZNF550; PATE1; TSTD2; ZNF417; ZNF572; GLYCTK; EGLN3; RIPPLY1; ZNF765; ATPAF2; SLC39A13; BMF; KRTAP9-4; CEP19; VPS25; MIEN1; P
Description of target
REL is a member of the Rel/NFKB family, which also includes RELA, RELB, NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain, ' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor. The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA (MIM 164014), RELB (604758), NFKB1 (MIM 164011), and NFKB2 (MIM 164012). These proteins are related through a highly conserved N-terminal region termed the 'Rel domain, ' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (MIM 164008) (Belguise and Sonenshein, 2007 [PubMed 18037997]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-174 CN414487.1 2-175 175-2323 X75042.1 128-2276 2324-2457 BX111941.1 575-708 2458-2592 AA279919.1 1-135 c
Nucleotide accession_num
NM_002908
Protein accession_num
NP_002899
Protein name
Proto-oncogene c-Rel
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human REL
Homology
Cow: 91%; Dog: 77%; Horse: 85%; Human: 100%; Pig: 93%; Rabbit: 86%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close