« Back
Home /
SMARCB1 Antibody - N-terminal region

SMARCB1 Antibody - N-terminal region

Item no.	ARP38220_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Aging & Neurological Disorders Neural Epigenetics Protein Aggregation, Clearance & Misfolding Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Sarcoma Immunohistochemistry Western Blot Primary Antibodies By Organ Bladder Cancer Glial Cell Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RDT,CSS3,INI1,SNF5,Snr1,BAF47,MRD15,RTPS1,Sfh1p,hSNFS,SNF5L1,SWNTS1,PPP1R144
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	37kDa
Species Tested	Human
Gene symbol	SMARCB1
Gene Fullname	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Protein size	339
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.
Nucleotide accession_num	NM_001007468.1
Protein accession_num	NP_001007469.1
Protein name	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of human SMARCB1
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer