« Back
Home /
SNAPC1 Antibody - C-terminal region

SNAPC1 Antibody - C-terminal region

Item no.	ARP38227_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Neural Development Antibodies By Cell Type Carcinoma Western Blot Cardiovascular Research Heart Failure Hypertension Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	GQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVIT
Citations	Gu,L., (2005) J. Biol. Chem. 280 (30), 27697-27704
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SNAP43,PTFgamma
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	43kDa
Species Tested	Human
Gene symbol	SNAPC1
Gene Fullname	Small nuclear RNA activating complex, polypeptide 1, 43kDa
Protein size	368
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; TBP; SNAPC2; RHOXF2; TRIM29; NR2E3; HOXA10; SNAPC4; SNAPC3; RB1; SNAPC5;
Description of target	SNAPC1 is a part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. It binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes and recruits TBP and BRF2 to the U6 snRNA TATA box.
Subunit	1
Nucleotide accession_num	NM_003082
Protein accession_num	NP_003073
Protein name	snRNA-activating protein complex subunit 1
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human SNAPC1
Homology	Human: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer