Comparison

TCF3 Antibody - N-terminal region

Item no. ARP38267_T100-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host Rabbit
Sequence MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL
Citations Maruyama,K. (2005) J. Biol. Chem. 280 (41), 34577-34589
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias E2A,E47,p75,AGM8,ITF1,VDIR,TCF-3,bHLHb21
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Neuroscience, Root Catalog/Research Areas/Acetylation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Research Areas/Cell Differentiation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature
Wet Ice
Molecular Weight
68kDa
Species Tested
Human
Gene symbol
TCF3
Gene Fullname
Transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Protein size
654
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
ID3; FAM115A; TLE1; RNF14; UBC; SCX; MAPKAPK2; MAPKAPK3; TCF21; Ube2i; ID2; FUS; CTNNB1; RPL37; MAX; USF1; TCF12; TCF3; MYOD1; Rufy1; Tfap4; Rpa1; Tbx6; Ncl; Twist2; SUPT3H; TRRAP; KAT2A; TADA2A; FOXH1; ELAVL1; TCF24; SETSIP; FLG2; BHLHA15; MYL6B; TIMM50;
Description of target
TCF3 contains 1 basic helix-loop-helix (bHLH) domain. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. TCF3 binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer.
Nucleotide accession_num
NM_003200
Protein accession_num
NP_003191
Protein name
Transcription factor E2-alpha
Clonality
Polyclonal
Purification
Protein A purified
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF3
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 77%; Rat: 100%
Concentration
1.0 mg/ml
Sample Type Confirmation

TCF3 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close