« Back
Home /
TEAD4 Antibody - N-terminal region

TEAD4 Antibody - N-terminal region

Item no.	ARP38275_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Antibodies Cell Biology Cell Status Cell Metabolism Immunohistochemistry Western Blot Oxidative Stress Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Horse (Equine), Pig (Porcine, Sus scrofa domesticus)
Host	Rabbit
Sequence	TAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TEF3,RTEF1,TEF-3,EFTR-2,TEFR-1,TCF13L1,hRTEF-1B
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Cell Biology, Root Catalog/Research Areas/E3 & Ubiquitin, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	44kDa
Species Tested	Human
Gene symbol	TEAD4
Gene Fullname	TEA domain family member 4
Protein size	391
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	CCDC172; SSX2IP; LZTS2; CEP70; CEP55; RABGEF1; CCNDBP1; KIAA0753; PNMA1; TRAF1; VPS52; TRIM27; GOLGA2; UBC; SUMO2; CCDC85B; WWTR1; YAP1; VGLL1; MYH7;
Description of target	TEAD4 is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. TEAD4 is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this protein.
Protein name	Transcriptional enhancer factor TEF-3
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Human TEAD4
Homology	Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer