« Back
Home /
TULP3 Antibody - N-terminal region

TULP3 Antibody - N-terminal region

Item no.	ARP38297_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Metabolism Glucose Homeostasis Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Neural Epigenetics Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	EKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTPLVNCHTPHSNVILHG
Citations	Santagata,S., (2001) Science 292 (5524), 2041-2050
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TUBL3
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/GPCR, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	50kDa
Species Tested	Human
Gene symbol	TULP3
Gene Fullname	Tubby like protein 3
Protein size	442
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	KRTAP10-5; KRTAP10-1; KRTAP10-7; ANKRD54; ROPN1; PSTPIP1; MAGEA6; vpr; UBC; SIRT1;
Description of target	TULP3 is a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.This gene encodes a member of the tubby-like protein (TULP) family. Members of this family have been identified in plants, vertebrates, and invertebrates, and they share a conserved C-terminal region of approximately 200 amino acid residues. The human and mouse TULP3 proteins share 69% amino acid sequence identity, with higher identity at the N and C termini than in the central region.
Nucleotide accession_num	NM_003324
Protein accession_num	NP_003315
Protein name	Tubby-related protein 3
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TULP3
Homology	Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer