« Back
Home /
COPS2 Antibody - N-terminal region

COPS2 Antibody - N-terminal region

Item no.	ARP38431_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Neural Lineage Markers Metabolism Cholesterol & Lipid Metabolism Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Cell Biology Cell Status Adenocarcinoma Immunohistochemistry Western Blot Senescence Primary Antibodies Astrocytoma By Organ Bladder Cancer Breast Cancer Bone Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAA
Citations	Pick, E. et al. The minimal deneddylase core of the COP9 signalosome excludes the Csn6 MPN- domain. PLoS One 7, e43980 (2012). 22956996 Moehren,U., (2004) (er) Nucleic Acids Res. 32 (10), 2995-3004
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CSN2,SGN2,ALIEN,TRIP15
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Products/Polyclonal Antibodies/Lymphocyte Signaling, Root Catalog/Products/Polyclonal Antibodies/Membrane Protein, Root Catalog/Research Areas/Developmental Biology, Root Catalog/Research Areas/Neuroscience, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Receptors, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	51kDa
Species Tested	Human
Gene symbol	COPS2
Gene Fullname	COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
Protein size	443
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; GPS1; Map3k10; 5830415F09Rik; Taf1b; EP300; Crebbp; cul1; COPS7B; EPB41L1; COPS5; FBXW4; SENP8; vpr; IRF5; COPS4; COPS7A; COPS6; COPS8; COPS3; PMPCA; SEPHS1; EHBP1L1; SLAIN2; GAPVD1; PFKFB2; SEPT2; IRS2; GRK5; DDB2; LRR1; DCAF11; DDA1; RFWD2; DCAF8;
Description of target	COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP. COPS2 is also innvolved in early stage of neuronal differentiation via its interaction with NIF3L1.
Subunit	2
Nucleotide accession_num	NM_004236
Protein accession_num	NP_004227
Protein name	COP9 signalosome complex subunit 2
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human COPS2
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Concentration	1.0 mg/ml
Sample Type Confirmation	COPS2 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer