« Back
Home /
NFKBIE Antibody - middle region

NFKBIE Antibody - middle region

Item no.	ARP38497_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Metabolism Cholesterol & Lipid Metabolism Aging & Neurological Disorders Antibodies By Cell Type Hematology Myeloma Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	DARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
Citations	Gerhard,D.S., (er) Ann. Rheum. Dis. (2008) In press
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	IKBE
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Various, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	53kDa
Species Tested	Human, Mouse
Gene symbol	NFKBIE
Gene Fullname	Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Protein size	500
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; KBTBD7; ANKHD1; RELA; C1QBP; LOC440434; HDAC5; HDAC4; NCOR2; CUL1; SKP1; PPP6C; JUP; REL; NFKB2; NFKB1; IL1A;
Description of target	NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-ka
Nucleotide accession_num	NM_004556
Protein accession_num	NP_004547
Protein name	NF-kappa-B inhibitor epsilon
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human NFKBIE
Homology	Cow: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 93%; Rat: 92%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer