« Back
Home /
Ciao1 Antibody - N-terminal region

Ciao1 Antibody - N-terminal region

Item no.	ARP38516_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Antibodies By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Myeloma Sarcoma Mesothelioma Western Blot Primary Antibodies By Organ Testicular & Prostate Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	MKDSLVLQSRVPAHPDSRCWFLAWNPSGTLLASCGGDRKIRIWGTEGDSW
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Wdr3,Wdr39,AW210570
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Mitochondria, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	38kDa
Species Tested	Mouse
Gene symbol	CIAO1
Protein size	339
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Iqcb1;
Description of target	Ciao1 is an essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. It is required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation.
Nucleotide accession_num	NM_025296
Protein accession_num	NP_079572
Protein name	Probable cytosolic iron-sulfur protein assembly protein CIAO1
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ciao1
Homology	Cow: 79%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer