« Back
Home /
NR1D2 Antibody - N-terminal region

NR1D2 Antibody - N-terminal region

Item no.	ARP38567_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	YISSSSSASSHASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL
Citations	Wang,J., (2008) Biochim. Biophys. Acta 1783 (2), 224-236
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	RVR,BD73,EAR-1R,REVERBB,REVERBbeta
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Meiosis\/Mitosis\/Cell Cycle, Root Catalog/Research Areas/Receptors, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	65kDa
Species Tested	Human
Gene symbol	NR1D2
Gene Fullname	Nuclear receptor subfamily 1, group D, member 2
Protein size	579
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	MID2; RBPMS; TRIM27; NOTCH2NL; KRTAP10-9; KRT40; KRTAP4-2; PRMT6; SKP1; UBC; SIN3B; KAT5; NCOR1; TAF9; TAF6; HDAC1; GTF2B; NCOA5; UBE2I; CUL1; NR1D1; RGN;
Description of target	NR1D2 can interact with NCOA5 coactivator, leading to a strong increase of transcription of target genes. NR1D2 also binds to the sequences 5'-AATGTAGGTCA-3' and 5'-ATAACTAGGTCA-3' and acts as a potent competitive transcriptional silencer and negative regulator of RORalpha mediated trans-activation. NR1D2 may play different roles in metabolism, inflammation, and circadian cycling in the organ-specific manner in homeostasis.
Nucleotide accession_num	NM_005126
Protein accession_num	NP_005117
Protein name	Nuclear receptor subfamily 1 group D member 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human NR1D2
Homology	Cow: 79%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer