« Back
Home /
ZNF263 Antibody - middle region

ZNF263 Antibody - middle region

Item no.	ARP38674_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	CHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHT
Citations	Martin,J., (2004) Nature 432 (7020), 988-994
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	FPM315,ZSCAN44,ZKSCAN12
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	77kDa
Species Tested	Human
Gene symbol	ZNF263
Gene Fullname	Zinc finger protein 263
Protein size	683
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	GPATCH2L; FAM115A; CLK3; CLK2; ZSCAN1; PCBD1; TRIM41; SCAND1; PLEKHF2; NME7; SPG21; ZNF446; SUFU; EFEMP2; DVL2;
Description of target	ZNF263 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF263 might play an important role in basic cellular processes as a transcriptional repressor.
Nucleotide accession_num	NM_005741
Protein accession_num	NP_005732
Protein name	Zinc finger protein 263
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ZNF263
Homology	Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer