« Back
Home /
ELL Antibody - N-terminal region

ELL Antibody - N-terminal region

Item no.	ARP38813_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Targets for Rodent Neurosciences Neural Signaling Neural Development Neural Adhesion Molecules Antibodies By Cell Type Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Sarcoma Myelofibrosis Immunohistochemistry Western Blot Primary Antibodies By Organ Thyroid Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Cow (Bos taurus)
Host	Rabbit
Sequence	GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ
Citations	Wiederschain,D., (2003) Mol. Cell. Biol. 23 (12), 4230-4246
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MEN,ELL1,PPP1R68,C19orf17
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Immunohistochemistry, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature	Wet Ice
Molecular Weight	68kDa
Species Tested	Human
Gene symbol	ELL
Gene Fullname	Elongation factor RNA polymerase II
Protein size	621
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; LOC100363176; SNF8; MCM2; Polr2e; Polr2l; Polr2h; Polr2d; Polr2a; Polr2c; Polr2i; Polr2b; Polr2j; Polr2g; Polr2f; EAF1; ICE2; AFF4; PPP1CA; ICE1; MED26; MLLT3; CDK9; TFPT; KMT2A; MLLT1; USPL1; EAF2; HNRNPU; TP53; ZHX1; SIRT2;
Description of target	ELL was shown to encode a previously uncharacterized elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA. Functionally, ELL resembles Elongin (SIII), a transcription elongation factor regulated by the product of the von Hippel-Lindau (VHL) tumor suppressor gene.
Nucleotide accession_num	NM_006532
Protein accession_num	NP_006523
Protein name	RNA polymerase II elongation factor ELL
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ELL
Homology	Cow: 93%; Dog: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer