NCOA2 Antibody - N-terminal region

Item no.	ARP38815_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Hematology Leukemia Western Blot Primary Antibodies By Organ Colorectal Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELA
Citations	Strehl,S., (2008) Clin. Cancer Res. 14 (4), 977-983
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	SRC2,TIF2,GRIP1,KAT13C,NCoA-2,bHLHe75
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Receptors, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal, Root Catalog/Research Areas/Cancer/Cancer Transcription Factor
Shipping Temperature	Wet Ice
Molecular Weight	159kDa
Species Tested	Human, Rat
Gene symbol	NCOA2
Gene Fullname	Nuclear receptor coactivator 2
Protein size	1464
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	VDR; PSMB9; PPARG; ESR1; PML; UBC; TP53; TAF9; Pias3; tat; THRB; NR3C1; EP300; NR1I2; RXRA; RARA; CREBBP; AHR; KANK2; MAGEA11; NCOA1; HHV8GK18_gp81; ESR2; PGR; SUMO2; CAD; ATR; HSPA2; CC2D1A; UBR5; TBK1; WDHD1; USO1; STAT6; NCOA3; THRA; CDK4; CCND3; EID1;
Description of target	NCOA2 is the transcriptional coactivator for steroid receptors and nuclear receptors. NCOA2 is the coactivator of the steroid binding domain (AF-2) but not of the modulating N-terminal domain (AF-1). NCOA2 is required with NCOA1 to control energy balance
Nucleotide accession_num	NM_006540
Protein accession_num	NP_006531
Protein name	Nuclear receptor coactivator 2
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human NCOA2
Homology	Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer