« Back
Home /
NT5C Antibody - C-terminal region

NT5C Antibody - C-terminal region

Item no.	ARP39112_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Antibodies By Cell Type Adenocarcinoma Immunohistochemistry Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB, IHC
Specific against	Human (Homo sapiens)
Host	Rabbit
Sequence	QEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DNT,cdN,DNT1,P5N2,PN-I,HEL74,PN-II,UMPH2,dNT-1
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	23kDa
Species Tested	Human
Gene symbol	NT5C
Gene Fullname	5', 3'-nucleotidase, cytosolic
Protein size	201
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; NT5C;
Description of target	This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene.
Nucleotide accession_num	NM_014595
Protein accession_num	NP_055410
Protein name	5'(3')-deoxyribonucleotidase, cytosolic type
Clonality	Polyclonal
Purification	Affinity Purified
Homology	Human: 100%
Concentration	0.5 mg/ml
Sample Type Confirmation	NT5C is supported by BioGPS gene expression data to be expressed in 721_B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer