« Back
Home /
ERGIC2 Antibody - N-terminal region

ERGIC2 Antibody - N-terminal region

Item no.	ARP39265_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Metabolism Glucose Homeostasis Antibodies Cell Biology Cell Status Necrosis Western Blot Primary Antibodies By Organ Testicular & Prostate Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIM
Citations	Breuza,L., (2004) J. Biol. Chem. 279 (45), 47242-47253
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PTX1,CDA14,Erv41,cd002
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Disease Related, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	43kDa
Species Tested	Human
Gene symbol	ERGIC2
Gene Fullname	ERGIC and golgi 2
Protein size	377
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	env; UBC; Copa;
Description of target	ERGIon Channel2 possibly play role in transport between endoplasmic reticulum and Golgi. ERGIon Channel2 is downregulated in prostate cancer. ERGIon Channel2 may play an important role in the growth and tumorigenicity of PC-3 prostate tumor cells. Ectopic expression of a partial sequence of ERGIon Channel2 as a VP22-fusion protein in prostate cancer cell line, PC-3, induced cellular senescence. Interferon-beta (IFN-beta) and a number of IFN-inducible genes were upregulated by the ERGIon Channel2-VP22 fusion protein.
Nucleotide accession_num	NM_016570
Protein accession_num	NP_057654
Protein name	Endoplasmic reticulum-Golgi intermediate compartment protein 2
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ERGIC2
Homology	Cow: 100%; Dog: 93%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 93%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer