« Back
Home /
RRN3 Antibody - middle region

RRN3 Antibody - middle region

Item no.	ARP39356_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Metabolism Diabetes Antibodies Western Blot Primary Antibodies
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig
Host	Rabbit
Sequence	DPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITP
Citations	Amit,M., (er) BMC Mol. Biol. 8, 109 (2007)
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TIFIA,A-270G1.2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	74kDa
Species Tested	Human
Gene symbol	RRN3
Gene Fullname	RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Protein size	651
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	UBC; ACTA1; Polr1e; POLR1B; EIF3L; NMI; RBM15; UBD; Trim28; ELAVL1; TAF1D; POLR1A; MYO1C; TAF1C; TAF1B; TAF1A; UBTF; TBP; PPP2R2A; CDK2; CCNE1; RIBIN; ACTB;
Description of target	RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of gene expression, namely results in rRNA synthesis in turn cell growth.
Nucleotide accession_num	NM_018427
Protein accession_num	NP_060897
Protein name	RNA polymerase I-specific transcription initiation factor RRN3
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human RRN3
Homology	Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Concentration	0.5 mg/ml
Sample Type Confirmation	RRN3 is supported by BioGPS gene expression data to be expressed in HeLa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer