« Back
Home /
ZNF395 Antibody - middle region

ZNF395 Antibody - middle region

Item no.	ARP39371_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Signaling Antibodies Western Blot Primary Antibodies By Organ Breast Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	HLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFL
Citations	Sichtig,N., (2007) Arch. Biochem. Biophys. 467 (1), 67-75
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PBF,PRF1,HDBP2,PRF-1,HDBP-2,HDRF-2,Si-1-8-14
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	55kDa
Species Tested	Human
Gene symbol	ZNF395
Gene Fullname	Zinc finger protein 395
Protein size	513
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	FBXW11; WASL; ELAVL1; SAP30; HDAC1;
Description of target	ZNF395 is a novel transcription factor shuttling between nucleus and cytoplasm and bind to the specific GCCGGCG, which is an essential cis-element for HD gene expression in neuronal cells. ZNF395 might play a role in transcription of PV genes and in E2-mediated repression.
Nucleotide accession_num	NM_018660
Protein accession_num	NP_061130
Protein name	Zinc finger protein 395
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ZNF395
Homology	Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer