« Back
Home /
PRDM12 Antibody - C-terminal region

PRDM12 Antibody - C-terminal region

Item no.	ARP39504_T100-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Antibodies Western Blot Primary Antibodies By Organ Heart & Blood Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host	Rabbit
Sequence	NHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPAL
Citations	Reid,A.G. (2004) Leukemia 18 (1), 178-180
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PFM9,HSAN8
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	40 kDa
Species Tested	Human
Gene symbol	PRDM12
Gene Fullname	PR domain containing 12
Protein size	367
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target	PRDM12 belongs to PR-domain family which are involved in human cancers in an unusual yin-yang fashion. Two products are normally produced from a PR-domain family member which differ by the presence or absence of the PR domain; the PR-plus product is disrupted or underexpressed whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, a result of either genetic or epigenetic events, appears to be an important cause of malignancy. PRDM12 may have a potential role in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion.
Nucleotide accession_num	NM_021619
Protein accession_num	NP_067632
Protein name	PR domain zinc finger protein 12
Clonality	Polyclonal
Purification	Protein A purified
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM12
Homology	Cow: 93%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 100%
Concentration	1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 10/30/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer