Comparison

PRDM12 Antibody - C-terminal region

Item no. ARP39504_T100-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus), Zebrafish (Danio rerio), Cow (Bos taurus)
Host Rabbit
Sequence NHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTALQAHSPAL
Citations Reid,A.G. (2004) Leukemia 18 (1), 178-180
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PFM9,HSAN8
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
40 kDa
Species Tested
Human
Gene symbol
PRDM12
Gene Fullname
PR domain containing 12
Protein size
367
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Description of target
PRDM12 belongs to PR-domain family which are involved in human cancers in an unusual yin-yang fashion. Two products are normally produced from a PR-domain family member which differ by the presence or absence of the PR domain; the PR-plus product is disrupted or underexpressed whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, a result of either genetic or epigenetic events, appears to be an important cause of malignancy. PRDM12 may have a potential role in the pathogenesis of chronic myeloid leukaemia with derivative chromosome 9 deletion.
Nucleotide accession_num
NM_021619
Protein accession_num
NP_067632
Protein name
PR domain zinc finger protein 12
Clonality
Polyclonal
Purification
Protein A purified
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM12
Homology
Cow: 93%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 100%; Zebrafish: 100%
Concentration
1.0 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close