Comparison

NIFK Antibody - middle region

Item no. ARP41054_P050-25UL
Manufacturer AVIVA Systems Biology
Amount 25 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host Rabbit
Sequence QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI
Citations Li,H., (2004) J. Mol. Biol. 335 (1), 371-381
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Nopp34,MKI67IP
Shipping Condition Cool pack
Available
Manufacturer - Type
Polyclonal Antibody
Manufacturer - Category
Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature
Wet Ice
Molecular Weight
32kDa
Species Tested
Human
Gene symbol
NIFK
Gene Fullname
nucleolar protein interacting with the FHA domain of MKI67
Protein size
293
Product format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins
TNIP1; SUMO3; UBC; LIN28B; SUMO1; ADARB1; EED; RNF2; CSNK2A2; Cbx5; Cbx3; Cbx1; CBX8; FTSJ3; NOP58; MED4; GNL3; RRS1; CDK19; RPL23; RPS24; RPS15A; RPS8; RPS6; RPS3; RPS2; RPL31; RPL30; RPL19; RPL18A; RPL18; RPL15; RPL11; RPL7; RPL5; RPL4; NOP2; NHP2L1; FB
Description of target
This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.
Nucleotide accession_num
NM_032390
Protein accession_num
NP_115766
Protein name
MKI67 FHA domain-interacting nucleolar phosphoprotein
Clonality
Polyclonal
Purification
Affinity Purified
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MKI67IP
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
Concentration
0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 25 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close