« Back
Home /
NIFK Antibody - middle region

NIFK Antibody - middle region

Item no.	ARP41054_P050
Manufacturer	AVIVA Systems Biology
Amount	100 ul
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Antibodies By Cell Type Blastoma Carcinoma Hematology Lymphoma Cell Biology Cell Status Western Blot Proliferation Viability Primary Antibodies By Organ Lung Cancer Bladder Cancer Breast Cancer Testicular & Prostate Cancer Cytoskeleton Markers
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Rabbit (Oryctolagus cuniculus), Guinea Pig, Dog (Canine, Canis lupus familiaris), Horse (Equine), Cow (Bos taurus)
Host	Rabbit
Sequence	QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI
Citations	Li,H., (2004) J. Mol. Biol. 335 (1), 371-381
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Nopp34,MKI67IP
Similar products	MKI67IP
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/RNA Binding Proteins, Root Catalog/Research Areas/Transcription Factors, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	32kDa
Species Tested	Human
Gene symbol	NIFK
Gene Fullname	nucleolar protein interacting with the FHA domain of MKI67
Protein size	293
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	TNIP1; SUMO3; UBC; LIN28B; SUMO1; ADARB1; EED; RNF2; CSNK2A2; Cbx5; Cbx3; Cbx1; CBX8; FTSJ3; NOP58; MED4; GNL3; RRS1; CDK19; RPL23; RPS24; RPS15A; RPS8; RPS6; RPS3; RPS2; RPL31; RPL30; RPL19; RPL18A; RPL18; RPL15; RPL11; RPL7; RPL5; RPL4; NOP2; NHP2L1; FB
Description of target	This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.
Nucleotide accession_num	NM_032390
Protein accession_num	NP_115766
Protein name	MKI67 FHA domain-interacting nucleolar phosphoprotein
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MKI67IP
Homology	Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/8/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer