« Back
Home /
PRKN Antibody - C-terminal region

PRKN Antibody - C-terminal region

Item no.	ARP43038_P050-25UL
Manufacturer	AVIVA Systems Biology
Amount	25 ul
Category	Oncology Neuroscience Neuroinflammation Neural Mitochondrial Function Neural Signaling Protein Aggregation, Clearance & Misfolding Antibodies By Cell Type Carcinoma Hematology Myeloma Cell Biology Cell Status Western Blot Autophagy Primary Antibodies By Organ Colorectal Cancer
Type	Antibody Polyclonal
Format	Liquid
Applications	WB
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus), Dog (Canine, Canis lupus familiaris), Pig (Porcine, Sus scrofa domesticus), Cow (Bos taurus)
Host	Rabbit
Sequence	YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG
Citations	Alternative splicing generates different parkin protein isoforms: evidences in human, rat, and mouse brain. Biomed Res Int. 2014, 690796 (2014). 25136611 Increasing the Coding Potential of Genomes Through Alternative Splicing: The Case of PARK2 Gene. Curr Genomics. 15, 203-16 (2014). 24955028 Ubiquitination as a Mechanism To Transport Soluble Mycobacterial and Eukaryotic Proteins to Exosomes. J Immunol. 195, 2722-30 (2015). 26246139
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P,Pa,Park2
Shipping Condition	Cool pack
Available
Manufacturer - Type	Polyclonal Antibody
Manufacturer - Category	Root Catalog/Products/Polyclonal Antibodies, Root Catalog/Products/Polyclonal Antibodies/Transcription Factor, Root Catalog/Products/Polyclonal Antibodies/Signal Proteins, Root Catalog/Research Areas/Chromatin & Nuclear Signaling, Root Catalog/Research Areas/Disease Related, Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions, Root Catalog/Research Areas/Autophagy, Root Catalog/Research Areas/Phosphorylation, Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies, Root Catalog/Products/Primary Antibodies, Root Catalog/Products/Aviva Rabbit Polyclonal
Shipping Temperature	Wet Ice
Molecular Weight	51kDa
Species Tested	Mouse
Gene symbol	PRKN
Gene Fullname	parkin RBR E3 ubiquitin protein ligase
Protein size	464
Product format	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Partner proteins	Becn1; Actb; Hdac6; TARDBP; Bax; Acta1; Ubc; Prps1; SNCA; Sh3gl2; Eps15; Synj1; Sh3gl3; Sh3gl1; Ambra1; Pick1; Cask; Abl1; Bcl2;
Nucleotide accession_num	NM_016694
Protein accession_num	NP_057903
Protein name	E3 ubiquitin-protein ligase parkin
Clonality	Polyclonal
Purification	Affinity Purified
Immunogen	The immunogen is a synthetic peptide corresponding to a region of Mouse
Homology	Cow: 92%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86%
Concentration	0.5 mg/ml

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25 ul

available

Delivery expected until 1/29/2026

Express Delivery: Save 14 days

Compare

Add to wishlist

Get an offer